PDB entry 2dao

View 2dao on RCSB PDB site
Description: Solution structure of ETS domain Transcriptional factor ETV6 protein
Class: DNA binding protein
Keywords: ETS domain, Transcription factor ETV6 protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-12-14, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor etv6
    Species: Homo sapiens [TaxId:9606]
    Gene: ETV6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41212 (7-111)
      • cloning artifact (0-6)
      • cloning artifact (112-117)
    Domains in SCOPe 2.07: d2daoa1, d2daoa2, d2daoa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2daoA (A:)
    gssgssgcrllwdyvyqllsdsryenfirwedkeskifrivdpnglarlwgnhknrtnmt
    yekmsralrhyyklniirkepgqrllfrfmktpdeimsgrtdrlehlesqelsgpssg