PDB entry 2da5

View 2da5 on RCSB PDB site
Description: Solution structure of the second homeobox domain of Zinc fingers and homeoboxes protein 3 (Triple homeobox 1 protein)
Class: DNA binding protein
Keywords: homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-12-13, released 2006-06-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc fingers and homeoboxes protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ZHX3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H4I2 (7-68)
      • cloning artifact (0-6)
      • cloning artifact (69-74)
    Domains in SCOPe 2.04: d2da5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2da5A (A:)
    gssgssgptkykerapeqlralessfaqnplpldeeldrlrsetkmtrreidswfserrk
    kvnaeetkksgpssg