PDB entry 2d9y

View 2d9y on RCSB PDB site
Description: Solution structure of the PH domain of PEPP-3 from human
Class: signaling protein
Keywords: PH domain, PEPP-3, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-12-13, released 2006-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pleckstrin homology domain-containing protein family A member 6
  Species: Homo sapiens [TaxId:9606]
  Gene: PLEKHA6
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y2H5 (7-110)
    • cloning artifact (0-6)
    • cloning artifact (111-116)
  Domains in SCOPe 2.05: d2d9ya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d9yA (A:)
  gssgssgnapvtkagwlfkqassgvkqwnkrwfvlvdrclfyykdekeesilgsipllsf
  rvaavqpsdnisrkhtfkaehagvrtyffsaespeeqeawiqamgeaarvqsgpssg