PDB entry 2d9x

View 2d9x on RCSB PDB site
Description: Solution structure of the PH domain of Oxysterol binding protein-related protein 11 from human
Class: lipid transport
Keywords: PH domain, OSBP-related protein 11, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIPID TRANSPORT
Deposited on 2005-12-13, released 2006-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxysterol binding protein-related protein 11
    Species: Homo sapiens [TaxId:9606]
    Gene: OSBPL11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BXB4 (7-113)
      • cloning artifact (0-6)
      • cloning artifact (114-119)
    Domains in SCOPe 2.05: d2d9xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d9xA (A:)
    gssgssgenvygylmkytnlvtgwqyrffvlnneaglleyfvneqsrnqkprgtlqlaga
    vispsdedshtftvnaasgeqyklratdakerqhwvsrlqictqhhteaigknnsgpssg