PDB entry 2d9e

View 2d9e on RCSB PDB site
Description: Solution structure of the Bromodomain of Peregrin
Class: Transcription
Keywords: FOUR-HELIX BUNDLE, transcription activator, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-12-09, released 2006-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1
    Database cross-references and differences (RAF-indexed):
    • GB CAD28495 (7-114)
      • cloning artifact (0-6)
      • cloning artifact (115-120)
    Domains in SCOPe 2.07: d2d9ea1, d2d9ea2, d2d9ea3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d9eA (A:)
    gssgssgflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleay
    rylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmgsgpss
    g