PDB entry 2d83

View 2d83 on RCSB PDB site
Description: The Crystal Structure of D-amino acid amidase from Ochrobactrum anthropi SV3
Class: hydrolase
Keywords: D-stereospecific, Amidase
Deposited on 2005-12-01, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-07-04, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d83a_
  • Chain 'B':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d83b_
  • Chain 'C':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d83c_
  • Chain 'D':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d83d_
  • Chain 'E':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d83e_
  • Chain 'F':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d83f_
  • Heterogens: BA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d83A (A:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d83A (A:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
    agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
    selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
    rs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d83B (B:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d83B (B:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
    agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
    selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
    rs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d83C (C:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d83C (C:)
    dlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasct
    ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd
    kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg
    mkdtwvgthetfpiereargymhadenpqwdvsgagdpvdgvwdstewfplsganaagdm
    vstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselk
    ghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d83D (D:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d83D (D:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaagdpvdgvwdstewfplsganaagdmvstprdiv
    kflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselkghlgqipg
    htsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2d83E (E:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d83E (E:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadknkmpmtgdhlfriasct
    ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd
    kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg
    mkdtwvgthetfpiereargymhapvdgvwdstewfplsganaagdmvstprdivkflna
    lfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselkghlgqipghtsim
    grdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2d83F (F:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d83F (F:)
    aiqgilddhvargvvgvslalclpgeetslyqsgyadkmpmtgdhlfriasctksfiatg
    lhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisdkswtaqe
    ivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplgmkdtwvg
    thetfpiereargymhwdstewfplsganaagdmvstprdivkflnalfdgrildqkrlw
    emkdnikpaffpgsntvanghglllmrygsselkghlgqipghtsimgrdeetgaalmli
    qnsgagdfesfylkgvnepvdrvleai