PDB entry 2d7c

View 2d7c on RCSB PDB site
Description: Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain
Class: protein transport
Keywords: GTP-ase, coiled-coil, PROTEIN TRANSPORT
Deposited on 2005-11-16, released 2006-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2008-10-21, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (0-166)
      • engineered (63)
    Domains in SCOPe 2.05: d2d7ca_
  • Chain 'B':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (0-166)
      • engineered (63)
    Domains in SCOPe 2.05: d2d7cb_
  • Chain 'C':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2d7cc1
  • Chain 'D':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2d7cd_
  • Heterogens: MG, GTP, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d7cA (A:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d7cB (B:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d7cC (C:)
    vsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d7cD (D:)
    vsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk