PDB entry 2d6o

View 2d6o on RCSB PDB site
Description: Crystal structure of mouse galectin-9 N-terminal CRD in complex with N-acetyllactosamine dimer
Class: sugar binding protein
Keywords: beta sandwich, carbohydrate binding protein, galectin, SUGAR BINDING PROTEIN
Deposited on 2005-11-14, released 2006-09-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: lectin, galactose binding, soluble 9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SXE6 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.02: d2d6ox_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >2d6oX (X:)
sgmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
vqyqhrvpyhlvdtiavsgclklsfitfqtqnfrpahqa

    Sequence, based on observed residues (ATOM records): (download) 
    >2d6oX (X:)
sgmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
vqyqhrvpyhlvdtiavsgclklsfitfqtq