PDB entry 2d6l

View 2d6l on RCSB PDB site
Description: Crystal structure of mouse galectin-9 N-terminal CRD (crystal form 2)
Class: sugar binding protein
Keywords: beta sandwich, carbohydrate binding protein, galectin, SUGAR BINDING PROTEIN
Deposited on 2005-11-14, released 2006-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: lectin, galactose binding, soluble 9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SXE6 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2d6lx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2d6lX (X:)
    gsmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
    fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
    vqyqhrvpyhlvdtiavsgclklsfitfqtqnfrpahqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6lX (X:)
    gsmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
    fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
    vqyqhrvpyhlvdtiavsgclklsfitfqtqn