PDB entry 2d69

View 2d69 on RCSB PDB site
Description: Crystal structure of the complex of sulfate ion and octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)
Class: Lyase
Keywords: alpha/beta barrel, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Lyase
Deposited on 2005-11-10, released 2006-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d69a1, d2d69a2
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d69b1, d2d69b2
  • Chain 'D':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d69d1, d2d69d2
  • Chain 'E':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d69e1, d2d69e2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d69A (A:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lskakvgvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d69A (A:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lska
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d69B (B:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lskakvgvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d69B (B:)
    vewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakr
    smakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppy
    eylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkd
    denftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggq
    yvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigv
    dqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdl
    viqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglskak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d69D (D:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lskakvgvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d69D (D:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrev
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2d69E (E:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lskakvgvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d69E (E:)
    ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
    makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
    ylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkdd
    enftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqy
    vmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvd
    qihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlv
    iqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslre