PDB entry 2d5r

View 2d5r on RCSB PDB site
Description: Crystal Structure of a Tob-hCaf1 Complex
Class: transcription
Keywords: poly(A) deadenylase, antiproliferative protein, transcription
Deposited on 2005-11-04, released 2006-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CCR4-NOT transcription complex subunit 7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d5ra1
  • Chain 'B':
    Compound: Tob1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50616 (1-115)
      • expression tag (0)
    Domains in SCOPe 2.08: d2d5rb1, d2d5rb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d5rA (A:)
    ricevwacnldeemkkirqvirkynyvamdtefpgvvarpigefrsnadyqyqllrcnvd
    llkiiqlgltfmneqgeyppgtstwqfnfkfnltedmyaqdsiellttsgiqfkkheeeg
    ietqyfaellmtsgvvlcegvkwlsfhsgydfgylikiltnsnlpeeeldffeilrlffp
    viydvkylmkscknlkgglqevaeqlelerigpqhqagsdslltgmaffkmremffedhi
    ddakycghlygl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d5rB (B:)
    hmqleiqvalnfiisylynklprrrvnifgeelerllkkkyeghwypekpykgsgfrcih
    igekvdpvieqaskesgldiddvrgnlpqdlsvwidpfevsyqigekgpvkvlyvd