PDB entry 2d5g

View 2d5g on RCSB PDB site
Description: Structure of ubiquitin fold protein R767E mutant
Class: signaling protein
Keywords: ubiquitin fold
Deposited on 2005-11-01, released 2006-11-01
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.228
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Axin-1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70239 (Start-84)
      • engineered (19)
    Domains in SCOP 1.75: d2d5ga1
  • Chain 'B':
    Compound: Axin-1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70239 (0-84)
      • engineered (19)
    Domains in SCOP 1.75: d2d5gb1
  • Chain 'C':
    Compound: Axin-1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70239 (Start-84)
      • engineered (19)
    Domains in SCOP 1.75: d2d5gc1
  • Chain 'D':
    Compound: Axin-1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70239 (Start-84)
      • engineered (19)
    Domains in SCOP 1.75: d2d5gd1
  • Chain 'E':
    Compound: Axin-1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70239 (Start-84)
      • engineered (19)
    Domains in SCOP 1.75: d2d5ge1
  • Chain 'F':
    Compound: Axin-1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70239 (Start-84)
      • engineered (19)
    Domains in SCOP 1.75: d2d5gf1
  • Heterogens: HG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d5gA (A:)
    ppcdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvf
    eevredeailpvfeekiigkvekvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d5gA (A:)
    cdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee
    vredeailpvfeekiigkvekvd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d5gB (B:)
    ppcdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvf
    eevredeailpvfeekiigkvekvd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d5gC (C:)
    ppcdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvf
    eevredeailpvfeekiigkvekvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d5gC (C:)
    cdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee
    vredeailpvfeekiigkvekvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d5gD (D:)
    ppcdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvf
    eevredeailpvfeekiigkvekvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d5gD (D:)
    cdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee
    vredeailpvfeekiigkvekvd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2d5gE (E:)
    ppcdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvf
    eevredeailpvfeekiigkvekvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d5gE (E:)
    ivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfeevre
    deailpvfeekiigkvekvd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2d5gF (F:)
    ppcdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvf
    eevredeailpvfeekiigkvekvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d5gF (F:)
    cdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee
    vredeailpvfeekiigkvekvd