PDB entry 2d4r

View 2d4r on RCSB PDB site
Description: Crystal structure of TTHA0849 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: START DOMAIN, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-10-23, released 2005-12-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.223
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTHA0849
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2d4ra1
  • Chain 'B':
    Compound: hypothetical protein TTHA0849
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2d4rb_
  • Chain 'C':
    Compound: hypothetical protein TTHA0849
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2d4rc_
  • Chain 'D':
    Compound: hypothetical protein TTHA0849
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2d4rd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d4rA (A:)
    mpevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkv
    rwleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllr
    klvqklmqenvesllkgleervlaass
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4rA (A:)
    pevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvr
    wleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrk
    lvqklmqenvesllkgleervlaass
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d4rB (B:)
    mpevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkv
    rwleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllr
    klvqklmqenvesllkgleervlaass
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4rB (B:)
    pevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvr
    wleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrk
    lvqklmqenvesllkgleervlaass
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d4rC (C:)
    mpevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkv
    rwleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllr
    klvqklmqenvesllkgleervlaass
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4rC (C:)
    pevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvr
    wleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrk
    lvqklmqenvesllkgleervlaas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d4rD (D:)
    mpevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkv
    rwleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllr
    klvqklmqenvesllkgleervlaass
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4rD (D:)
    pevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvr
    wleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrk
    lvqklmqenvesllkgleervlaass