PDB entry 2d4h

View 2d4h on RCSB PDB site
Description: Crystal-structure of the N-terminal large GTPase Domain of human Guanylate Binding protein 1 (hGBP1) in complex with GMP
Class: signaling protein
Keywords: Protein- guanine nucleotide complex, SIGNALING PROTEIN
Deposited on 2005-10-19, released 2006-03-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.235
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon-induced guanylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d4ha1, d2d4ha2
  • Chain 'B':
    Compound: interferon-induced guanylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d4hb1, d2d4hb2
  • Heterogens: 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d4hA (A:)
    mhhhhhhmrgsmaseihmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrt
    gksylmnklagkkkgfslgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdn
    qndswifalavllsstfvynsigtinqqamdqlyyvtelthrirsksspdenenevedsa
    dfvsffpdfvwtlrdfsldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkf
    fpkkkcfvfdrpvhrrklaqleklqdeeldpefvqqvadfcsyifsnsktktlsggiqvn
    gprleslvltyvnaissgdlpcmenavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4hA (A:)
    ihmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkg
    fslgstvqkgiwmwcvphpkkpghilvlldteglgdvenqndswifalavllsstfvyns
    igtinqqamdqlyyvtelthrirsksspdesadfvsffpdfvwtlrdfsldleadgqplt
    pdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrrklaqleklqdee
    ldpefvqqvadfcsyifsnsktktlsggiqvngprleslvltyvnaissgdlpcmenav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d4hB (B:)
    mhhhhhhmrgsmaseihmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrt
    gksylmnklagkkkgfslgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdn
    qndswifalavllsstfvynsigtinqqamdqlyyvtelthrirsksspdenenevedsa
    dfvsffpdfvwtlrdfsldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkf
    fpkkkcfvfdrpvhrrklaqleklqdeeldpefvqqvadfcsyifsnsktktlsggiqvn
    gprleslvltyvnaissgdlpcmenavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4hB (B:)
    hmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkgf
    slgskgiwmwcvphpkkpghilvlldteglgqndswifalavllsstfvynsigtinqqa
    mdqlyyvtelthrirskssdsadfvsffpdfvwtlrdfsldleadgqpltpdeyltyslk
    lkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrrklaqleklqdeeldpefvqqva
    dfcsyifsnsktktlsggiqvngprleslvltyvnaissgdlpc