PDB entry 2d4e

View 2d4e on RCSB PDB site
Description: Crystal Structure of the HpcC from Thermus Thermophilus HB8
Class: oxidoreductase
Keywords: HpcC, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2005-10-18, released 2006-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_144225 (Start-514)
    Domains in SCOPe 2.07: d2d4ea_
  • Chain 'B':
    Compound: 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_144225 (Start-514)
    Domains in SCOPe 2.07: d2d4eb_
  • Chain 'C':
    Compound: 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_144225 (0-514)
    Domains in SCOPe 2.07: d2d4ec_
  • Chain 'D':
    Compound: 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_144225 (0-514)
    Domains in SCOPe 2.07: d2d4ed_
  • Heterogens: NA, NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d4eA (A:)
    mryadrvagiswetieevrrrlkerpalhfiagefvpsesgetfpsldpatnevlgvaar
    ggerevdraakaaheafqrwsrtkakerkryllriaeliekhadelavmecldagqvlri
    vraqvaraaenfafyaeyaehamedrtfpvdrdwlyytvrvpagpvgiitpwnaplmlst
    wriapalafgntvvlkpaewspftatklaeilkeadlppgvfnlvqgfgeeagaalvahp
    lvplltltgetetgkivmrnaadhlkrlspelggkspalvfadadleraldavvfqifsf
    ngerctassrllveekifedfvgkvverarairvghpldpetevgplihpehlqrvlgyv
    eagkregarllvggeraktsfrgedlsrgnyllptvfvgenhmkiaqeeifgpvlvaipf
    kdeeealrkandtkyglaayvftrdlerahrlaleleagmvylnshnvrhlptpfggvkg
    sgdrreggtyaldfytdlktialplrpphvpkfgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4eA (A:)
    yadrvagiswetieevrrrlkerpalhfiagefvpsesgetfpsldpatnevlgvaargg
    erevdraakaaheafqrwsrtkakerkryllriaeliekhadelavmecldagqvlrivr
    aqvaraaenfafyaeyaehamedrtfpvdrdwlyytvrvpagpvgiitpwnaplmlstwr
    iapalafgntvvlkpaewspftatklaeilkeadlppgvfnlvqgfgeeagaalvahplv
    plltltgetetgkivmrnaadhlkrlspelggkspalvfadadleraldavvfqifsfng
    erctassrllveekifedfvgkvverarairvghpldpetevgplihpehlqrvlgyvea
    gkregarllvggeraktsfrgedlsrgnyllptvfvgenhmkiaqeeifgpvlvaipfkd
    eeealrkandtkyglaayvftrdlerahrlaleleagmvylnshnvrhlptpfggvkgsg
    drreggtyaldfytdlktialplrpphvpkfgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d4eB (B:)
    mryadrvagiswetieevrrrlkerpalhfiagefvpsesgetfpsldpatnevlgvaar
    ggerevdraakaaheafqrwsrtkakerkryllriaeliekhadelavmecldagqvlri
    vraqvaraaenfafyaeyaehamedrtfpvdrdwlyytvrvpagpvgiitpwnaplmlst
    wriapalafgntvvlkpaewspftatklaeilkeadlppgvfnlvqgfgeeagaalvahp
    lvplltltgetetgkivmrnaadhlkrlspelggkspalvfadadleraldavvfqifsf
    ngerctassrllveekifedfvgkvverarairvghpldpetevgplihpehlqrvlgyv
    eagkregarllvggeraktsfrgedlsrgnyllptvfvgenhmkiaqeeifgpvlvaipf
    kdeeealrkandtkyglaayvftrdlerahrlaleleagmvylnshnvrhlptpfggvkg
    sgdrreggtyaldfytdlktialplrpphvpkfgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4eB (B:)
    yadrvagiswetieevrrrlkerpalhfiagefvpsesgetfpsldpatnevlgvaargg
    erevdraakaaheafqrwsrtkakerkryllriaeliekhadelavmecldagqvlrivr
    aqvaraaenfafyaeyaehamedrtfpvdrdwlyytvrvpagpvgiitpwnaplmlstwr
    iapalafgntvvlkpaewspftatklaeilkeadlppgvfnlvqgfgeeagaalvahplv
    plltltgetetgkivmrnaadhlkrlspelggkspalvfadadleraldavvfqifsfng
    erctassrllveekifedfvgkvverarairvghpldpetevgplihpehlqrvlgyvea
    gkregarllvggeraktsfrgedlsrgnyllptvfvgenhmkiaqeeifgpvlvaipfkd
    eeealrkandtkyglaayvftrdlerahrlaleleagmvylnshnvrhlptpfggvkgsg
    drreggtyaldfytdlktialplrpphvpkfgk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d4eC (C:)
    mryadrvagiswetieevrrrlkerpalhfiagefvpsesgetfpsldpatnevlgvaar
    ggerevdraakaaheafqrwsrtkakerkryllriaeliekhadelavmecldagqvlri
    vraqvaraaenfafyaeyaehamedrtfpvdrdwlyytvrvpagpvgiitpwnaplmlst
    wriapalafgntvvlkpaewspftatklaeilkeadlppgvfnlvqgfgeeagaalvahp
    lvplltltgetetgkivmrnaadhlkrlspelggkspalvfadadleraldavvfqifsf
    ngerctassrllveekifedfvgkvverarairvghpldpetevgplihpehlqrvlgyv
    eagkregarllvggeraktsfrgedlsrgnyllptvfvgenhmkiaqeeifgpvlvaipf
    kdeeealrkandtkyglaayvftrdlerahrlaleleagmvylnshnvrhlptpfggvkg
    sgdrreggtyaldfytdlktialplrpphvpkfgk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d4eD (D:)
    mryadrvagiswetieevrrrlkerpalhfiagefvpsesgetfpsldpatnevlgvaar
    ggerevdraakaaheafqrwsrtkakerkryllriaeliekhadelavmecldagqvlri
    vraqvaraaenfafyaeyaehamedrtfpvdrdwlyytvrvpagpvgiitpwnaplmlst
    wriapalafgntvvlkpaewspftatklaeilkeadlppgvfnlvqgfgeeagaalvahp
    lvplltltgetetgkivmrnaadhlkrlspelggkspalvfadadleraldavvfqifsf
    ngerctassrllveekifedfvgkvverarairvghpldpetevgplihpehlqrvlgyv
    eagkregarllvggeraktsfrgedlsrgnyllptvfvgenhmkiaqeeifgpvlvaipf
    kdeeealrkandtkyglaayvftrdlerahrlaleleagmvylnshnvrhlptpfggvkg
    sgdrreggtyaldfytdlktialplrpphvpkfgk