PDB entry 2d3v

View 2d3v on RCSB PDB site
Description: Crystal Structure of Leukocyte Ig-like Receptor A5 (LILRA5/LIR9/ILT11)
Class: immune system
Keywords: Immunoglobulin-like fold, IMMUNE SYSTEM
Deposited on 2005-10-03, released 2006-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.235
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_067073
      • modified residue (64)
      • modified residue (169)
    Domains in SCOPe 2.07: d2d3va1, d2d3va2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d3vA (A:)
    gnlskatlwaepgsvisrgnsvtircqgtleaqeyrlvkegspepwdtqnplepknkarf
    sipsmtehhagryrcyyyspagwsepsdplelvvtgfynkptlsalpspvvtsgenvtlq
    cgsrlrfdrfilteegdhklswtldsqltpsgqfqalfpvgpvtpshrwmlrcygsrrhi
    lqvwsepsdlleipvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3vA (A:)
    lskatlwaepgsvisrgnsvtircqgtleaqeyrlvkegspepwdtqnplepknkarfsi
    psmtehhagryrcyyyspagwsepsdplelvvtgfynkptlsavtlqcgsrlrfdrfilt
    eeklswtldsqltpsgqfqalfpvgpvtpshrwmlrcygsrrhilqvwsepsdlleipv