PDB entry 2d3t

View 2d3t on RCSB PDB site
Description: Fatty Acid beta-oxidation multienzyme complex from Pseudomonas Fragi, Form V
Class: lyase, oxidoreductase/transferase
Keywords: alpha2beta2 heterotetrameric complex, LYASE, OXIDOREDUCTASE/TRANSFERASE COMPLEX
Deposited on 2005-10-01, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.242
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty oxidation complex alpha subunit
    Species: Pseudomonas fragi [TaxId:296]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d3ta1, d2d3ta2, d2d3ta3, d2d3ta4
  • Chain 'B':
    Compound: Fatty oxidation complex alpha subunit
    Species: Pseudomonas fragi [TaxId:296]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d3tb1, d2d3tb2, d2d3tb3, d2d3tb4
  • Chain 'C':
    Compound: 3-ketoacyl-CoA thiolase
    Species: Pseudomonas fragi [TaxId:296]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d3tc1, d2d3tc2
  • Chain 'D':
    Compound: 3-ketoacyl-CoA thiolase
    Species: Pseudomonas fragi [TaxId:296]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d3td1, d2d3td2
  • Heterogens: ACO, NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d3tA (A:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayeadkkgkq
    kklvdssvlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvy
    gigfplfrggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3tA (A:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayekklvdss
    vlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvygigfplf
    rggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d3tB (B:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayeadkkgkq
    kklvdssvlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvy
    gigfplfrggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3tB (B:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayeadqkklv
    dssvlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvygigf
    plfrggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d3tC (C:)
    slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
    vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
    vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
    katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
    ssqitdgascmivmsaqrakdlgleplavirsmavagvdpaimgygpvpatqkalkragl
    nmadidfielneafaaqalpvlkdlkvldkmnekvnlhggaialghpfgcsgarisgtll
    nvmkqnggtfglstmciglgqgiatvferv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d3tD (D:)
    slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
    vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
    vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
    katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
    ssqitdgascmivmsaqrakdlgleplavirsmavagvdpaimgygpvpatqkalkragl
    nmadidfielneafaaqalpvlkdlkvldkmnekvnlhggaialghpfgcsgarisgtll
    nvmkqnggtfglstmciglgqgiatvferv