PDB entry 2d33

View 2d33 on RCSB PDB site
Description: Crystal Structure of gamma-Glutamylcysteine Synthetase Complexed with Aluminum Fluoride
Class: Ligase
Keywords: glutathione homeostasis, peptide synthesis, phosphoryl transfer, Ligase
Deposited on 2005-09-25, released 2006-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.164
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: gshI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-517)
      • engineered (105)
      • engineered (204)
      • engineered (222)
    Domains in SCOPe 2.08: d2d33a_
  • Chain 'B':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: gshI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-517)
      • engineered (105)
      • engineered (163)
      • engineered (204)
      • engineered (222)
    Domains in SCOPe 2.08: d2d33b_
  • Chain 'C':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: gshI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-517)
      • engineered (105)
      • engineered (204)
    Domains in SCOPe 2.08: d2d33c_
  • Chain 'D':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: gshI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-End)
      • engineered (105)
      • engineered (204)
      • engineered (222)
    Domains in SCOPe 2.08: d2d33d_
  • Heterogens: MG, GLU, CYS, ADP, AF3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d33A (A:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d33A (A:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgadakekisagyfrvi
    rnyyrfgwvipylfgaspaisssfltslpfektesgmyylpyatslrlsdlgytnksqsn
    lgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrv
    trsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemsss
    elactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggea
    yqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedf
    vaereaserrqqemeaadtepfavwlekha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d33B (B:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d33B (B:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksakekisagyfrvirny
    yrfgwvipylfgaspaisssflslpfektesgmyylpyatslrlsdlgytnsnlgitfnd
    lyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsgesp
    sdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactrv
    nwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcde
    lvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaereas
    errqqemeaadtepfavwlekha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d33C (C:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d33C (C:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqakisgadakekisagyfrv
    irnyyrfgwvipylfgaspaisssflslpfektmyylpyatslrlsdlgytnsnlgitfn
    dlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsges
    psdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactr
    vnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcd
    elvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaerea
    serrqqemeaadtepfavwlekha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d33D (D:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d33D (D:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqakekisagyfrvirnyyrf
    gwvipylfgaspaisssflslpfektesgmyylpyatslrlsdlgytnsnlgitfndlye
    yvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsgespsda
    llrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactrvnwn
    rvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcdelva
    cfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaereaserr
    qqemeaadtepfavwlekh