PDB entry 2d32

View 2d32 on RCSB PDB site
Description: Crystal Structure of Michaelis Complex of gamma-Glutamylcysteine Synthetase
Class: Ligase
Keywords: glutathione homeostasis, peptide synthesis, phosphoryl transfer
Deposited on 2005-09-25, released 2006-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli
    Gene: gshI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-517)
      • engineered (105)
      • engineered (204)
      • engineered (222)
    Domains in SCOP 1.75: d2d32a1
  • Chain 'B':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli
    Gene: gshI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-517)
      • engineered (105)
      • engineered (204)
      • engineered (222)
    Domains in SCOP 1.75: d2d32b1
  • Chain 'C':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli
    Gene: gshI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-End)
      • engineered (105)
      • engineered (204)
    Domains in SCOP 1.75: d2d32c1
  • Chain 'D':
    Compound: Glutamate--cysteine ligase
    Species: Escherichia coli
    Gene: gshI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6W9 (0-517)
      • engineered (105)
      • engineered (204)
      • engineered (222)
    Domains in SCOP 1.75: d2d32d1
  • Heterogens: MG, GLU, CYS, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d32A (A:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d32A (A:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgadakekisagyfrvi
    rnyyrfgwvipylfgaspaisssfltslpfektesgmyylpyatslrlsdlgytnksqsn
    lgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrv
    trsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemsss
    elactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggea
    yqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedf
    vaereaserrqqemeaadtepfavwlekha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d32B (B:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d32B (B:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqakkekisagyfrvirnyyr
    fgwvipylfgaspaisssfltslpfektesgmyylpyatslrlsdlgytnqsnlgitfnd
    lyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrespsd
    allrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactrvnw
    nrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcdelv
    acfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaereaser
    rqqemeaaepfavwlekha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d32C (C:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d32C (C:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiadielaqygtsn
    tgrfktlyreglknrygalmqtisgvhynfslpmafwqakisgadakekisagyfrvirn
    yyrfgwvipylfgaspaisssfslpfektmyylpyatslrlsdlgytnqsnlgitfndly
    eyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsgespsd
    allrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactrvnw
    nrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcdelv
    acfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaereaser
    rqqemeaadtepfavwlek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d32D (D:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
    frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
    ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
    apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
    dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
    dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
    eilreedfvaereaserrqqemeaadtepfavwlekha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d32D (D:)
    mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
    faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
    tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqakakekisagyfrvirnyy
    rfgwvipylfgaspaisssfltslpfektesgmyylpyatslrlsdlgytnqsnlgitfn
    dlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsges
    psdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactr
    vnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcd
    elvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaerea
    serrqqemeaadtepfavwlekha