PDB entry 2d2q

View 2d2q on RCSB PDB site
Description: Crystal structure of the dimerized radixin FERM domain
Class: cell adhesion
Keywords: Homo dimer, Masking, CELL ADHESION
Deposited on 2005-09-15, released 2006-04-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d2qA (A:)
    mpkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlk
    lnkkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycppe
    tavllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwheehr
    gmlredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpkigf
    pwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdti
    evqqmkaqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2qA (A:)
    kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
    kkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycppeta
    vllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwheehrgm
    lredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpw
    seirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d2qB (B:)
    mpkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlk
    lnkkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycppe
    tavllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwheehr
    gmlredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpkigf
    pwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdti
    evqqmkaqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2qB (B:)
    kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
    kkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycppeta
    vllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwheehrgm
    lredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpw
    seirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtiev
    qq