PDB entry 2d2o

View 2d2o on RCSB PDB site
Description: Structure of a complex of Thermoactinomyces vulgaris R-47 alpha-amylase 2 with maltohexaose demonstrates the important role of aromatic residues at the reducing end of the substrate binding cleft
Class: Hydrolase
Keywords: beta/alpha barrel, Hydrolase
Deposited on 2005-09-13, released 2006-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neopullulanase 2
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08751 (0-584)
      • engineered (324)
    Domains in SCOPe 2.06: d2d2oa1, d2d2oa2, d2d2oa3
  • Chain 'B':
    Compound: Neopullulanase 2
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08751 (0-584)
      • engineered (324)
    Domains in SCOPe 2.06: d2d2ob1, d2d2ob2, d2d2ob3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2oA (A:)
    mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
    gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
    vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
    yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
    vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
    pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
    gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
    dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
    rglfefykelirlrhrlasltrgnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqt
    vllqvpesggktwldcltgeevhgkqgqlkltlrpyqgmilwngr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2oB (B:)
    mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
    gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
    vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
    yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
    vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
    pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
    gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
    dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
    rglfefykelirlrhrlasltrgnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqt
    vllqvpesggktwldcltgeevhgkqgqlkltlrpyqgmilwngr