PDB entry 2d2m

View 2d2m on RCSB PDB site
Description: Structure of an extracellular giant hemoglobin of the gutless beard worm Oligobrachia mashikoi
Class: oxygen storage/transport
Keywords: giant hemoglobin, sulfide binding, invertebrate, pogonophora, oligobrachia mashikoi, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2005-09-12, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.236
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Giant hemoglobin, A1(b) globin chain
    Species: Oligobrachia mashikoi [TaxId:55676]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d2ma_
  • Chain 'B':
    Compound: Giant hemoglobin, A2(a5) globin chain
    Species: Oligobrachia mashikoi [TaxId:55676]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d2mb_
  • Chain 'C':
    Compound: Giant hemoglobin, B2(c) globin chain
    Species: Oligobrachia mashikoi [TaxId:55676]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d2mc_
  • Chain 'D':
    Compound: Giant hemoglobin, B1(d) globin chain
    Species: Oligobrachia mashikoi [TaxId:55676]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d2md_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2mA (A:)
    vcnrleqilvktqwaqsygeaenraafsrdlfselfniqgssralfsgvgvddmnsaaft
    ahclrvtgalnrlisqldqqatinadlahlagqhasrnldasnfaamgqavmsvvpthld
    cfnqhawgecyeriasgisg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2mB (B:)
    dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq
    ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg
    arsfdndawnscmnqivsgisg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d2mC (C:)
    ssccssedranvmhnwdaawsaaysdrrvalaqavfaslfsrdaaaqglfsgvsadnpds
    adfrahcvrvvngldvainmlndpavlneqlahlsaqhqaragvaaahfdvmaeafaevm
    pqvsscfssdswnrcfariangisagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2mC (C:)
    sccssedranvmhnwdaawsaaysdrrvalaqavfaslfsrdaaaqglfsgvsadnpdsa
    dfrahcvrvvngldvainmlndpavlneqlahlsaqhqaragvaaahfdvmaeafaevmp
    qvsscfssdswnrcfariangisagl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2mD (D:)
    eccsrgdaevvisewdqvfnaamagssesavgvaifdaffassgvspsmfpgggdsnnpe
    flaqvsrvvsgadiainsltnratcdsllshlnaqhraisgvtgaavthlsqaissvvaq
    vlpsahidaweycmayiaagigagl