PDB entry 2d2c

View 2d2c on RCSB PDB site
Description: Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus
Class: photosynthesis
Keywords: Photosynthesis
Deposited on 2005-09-07, released 2005-12-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.276
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b6
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2ca1
  • Chain 'B':
    Compound: Cytochrome b6-f complex subunit 4
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2cb1
  • Chain 'C':
    Compound: Apocytochrome f
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cytochrome b6-f complex iron-sulfur subunit
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83794 (Start-178)
      • conflict (137)
    Domains in SCOPe 2.04: d2d2cd1, d2d2cd2
  • Chain 'E':
    Compound: Cytochrome b6-f complex subunit VI
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2ce1
  • Chain 'F':
    Compound: Cytochrome b6-f complex subunit VII
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2cf1
  • Chain 'G':
    Compound: Cytochrome b6-f complex subunit V
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2cg1
  • Chain 'H':
    Compound: Cytochrome b6-f complex subunit VIII
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2ch1
  • Chain 'N':
    Compound: Cytochrome b6
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2cn1
  • Chain 'O':
    Compound: Cytochrome b6-f complex subunit 4
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2co1
  • Chain 'P':
    Compound: Apocytochrome f
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Cytochrome b6-f complex iron-sulfur subunit
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83794 (Start-178)
      • conflict (137)
    Domains in SCOPe 2.04: d2d2cq1, d2d2cq2
  • Chain 'R':
    Compound: Cytochrome b6-f complex subunit VI
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2cr1
  • Chain 'S':
    Compound: Cytochrome b6-f complex subunit VII
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2cs1
  • Chain 'T':
    Compound: Cytochrome b6-f complex subunit V
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2ct1
  • Chain 'U':
    Compound: Cytochrome b6-f complex subunit VIII
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d2cu1
  • Heterogens: HEM, HEC, OPC, BNT, CLA, FES, BCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d2cA (A:)
    manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
    tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
    gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
    tryysahtfvlpwliavfmllhflmirkqgisgpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2cA (A:)
    eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
    mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
    vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
    wliavfmllhflmirkqgisgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d2cB (B:)
    matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
    mvgepanpfatpleilpewylypvfqilrslpnkllgvllmasvplglilvpfienvnkf
    qnpfrrpvattiflfgtlvtiwlgigaalpldktltlglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2cB (B:)
    lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp
    ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt
    lvtiwlgigaalpldkt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d2cD (D:)
    maqftesmdvpdmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdkl
    gnnvkvskfleshnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaa
    enkfkcpchgsqydetgrvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2cD (D:)
    dmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdklgnnvkvskfle
    shnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaaenkfkcpchgs
    qydetgrvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2cE (E:)
    milgavfyivfialffgiavgiifaiksikli
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2cF (F:)
    mteemlyaallsfglifvgwglgvlllkiqgaeke
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2d2cG (G:)
    mveplldglvlglvfatlgglfyaayqqykrpnelgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2cG (G:)
    lvlglvfatlgglfyaayqqykrpnel
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2d2cH (H:)
    meidvlgwvallvvftwsiamvvwgrngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2cH (H:)
    idvlgwvallvvftwsiamvvwgrngl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2d2cN (N:)
    manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
    tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
    gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
    tryysahtfvlpwliavfmllhflmirkqgisgpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2cN (N:)
    eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
    mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
    vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
    wliavfmllhflmirkqgisgp
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2d2cO (O:)
    matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
    mvgepanpfatpleilpewylypvfqilrslpnkllgvllmasvplglilvpfienvnkf
    qnpfrrpvattiflfgtlvtiwlgigaalpldktltlglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2cO (O:)
    lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp
    ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt
    lvtiwlgigaalpldkt
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2d2cQ (Q:)
    maqftesmdvpdmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdkl
    gnnvkvskfleshnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaa
    enkfkcpchgsqydetgrvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2cQ (Q:)
    dmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdklgnnvkvskfle
    shnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaaenkfkcpchgs
    qydetgrvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2cR (R:)
    milgavfyivfialffgiavgiifaiksikli
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2cS (S:)
    mteemlyaallsfglifvgwglgvlllkiqgaeke
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2d2cT (T:)
    mveplldglvlglvfatlgglfyaayqqykrpnelgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2cT (T:)
    lvlglvfatlgglfyaayqqykrpnel
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2d2cU (U:)
    meidvlgwvallvvftwsiamvvwgrngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2cU (U:)
    idvlgwvallvvftwsiamvvwgrngl