PDB entry 2d1x

View 2d1x on RCSB PDB site
Description: The crystal structure of the cortactin-SH3 domain and AMAP1-peptide complex
Class: cell invasion
Keywords: sh3, proline-rich, complex, cell invasion
Deposited on 2005-09-01, released 2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cortactin isoform a
    Species: Homo sapiens [TaxId:9606]
    Gene: CTTN(AMINO ACIDS 490-550)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d1xa_
  • Chain 'B':
    Compound: cortactin isoform a
    Species: Homo sapiens [TaxId:9606]
    Gene: CTTN(AMINO ACIDS 490-550)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d1xb_
  • Chain 'C':
    Compound: cortactin isoform a
    Species: Homo sapiens [TaxId:9606]
    Gene: CTTN(AMINO ACIDS 490-550)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14247 (5-65)
      • cloning artifact (0-4)
    Domains in SCOPe 2.08: d2d1xc1, d2d1xc2
  • Chain 'D':
    Compound: cortactin isoform a
    Species: Homo sapiens [TaxId:9606]
    Gene: CTTN(AMINO ACIDS 490-550)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d1xd_
  • Chain 'P':
    Compound: proline rich region from development and differentiation enhancing factor 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_060952
  • Chain 'Q':
    Compound: proline rich region from development and differentiation enhancing factor 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_060952
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2d1xA (A:)
gplgsendlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpan
yvelrq

    Sequence, based on observed residues (ATOM records): (download) 
    >2d1xA (A:)
ndlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2d1xB (B:)
gplgsendlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpan
yvelrq

    Sequence, based on observed residues (ATOM records): (download) 
    >2d1xB (B:)
dlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2d1xC (C:)
gplgsendlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpan
yvelrq

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >2d1xD (D:)
gplgsendlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpan
yvelrq

    Sequence, based on observed residues (ATOM records): (download) 
    >2d1xD (D:)
dlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.