PDB entry 2d1r

View 2d1r on RCSB PDB site
Description: Crystal structure of the thermostable Japanese firefly Luciferase complexed with OXYLUCIFERIN and AMP
Class: Oxidoreductase
Keywords: ALPHA/BETA, BETA BARREL, ALPHA+BETA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, Oxidoreductase
Deposited on 2005-08-31, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.185
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Luciferin 4-monooxygenase
    Species: Luciola cruciata [TaxId:7051]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13129
      • modified residue (62-63)
      • engineered (216)
    Domains in SCOPe 2.07: d2d1ra_
  • Heterogens: AMP, OLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d1rA (A:)
    menmendenivvgpkpfypieegsagtqlrkymeryaklgaiaftnavtgvdysyaeyle
    kscclgkalqnyglvvdgrialcsenceeffipviaglfigvgvaptneiytlrelvhsl
    giskptivfsskkgldkvitvqktvttiktivildskvdyrgyqcldtfikrntppgfqa
    ssfktvevdrkeqvalimnssgstglpkgvqlthenivtrfshardpiygnqvspgtavl
    tvvpfhhgfgmfttlgylicgfrvvmltkfdeetflktlqdykctsvilvptlfailnks
    ellnkydlsnlveiasggaplskevgeavarrfnlpgvrqgygltettsaiiitpegddk
    pgasgkvvplfkakvidldtkkslgpnrrgevcvkgpmlmkgyvnnpeatkelideegwl
    htgdigyydeekhffivdrlkslikykgyqvppaelesvllqhpsifdagvagvpdpvag
    elpgavvvlesgknmtekevmdyvasqvsnakrlrggvrfvdevpkgltgkidgrairei
    lkkpvakm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d1rA (A:)
    denivvgpkpfypieegsagtqlrkymeryaklgaiaftnavtgvdysyaeylekscclg
    kalqnyglvvdgrialcsenceeffipviaglfigvgvaptneiytlrelvhslgiskpt
    ivfsskkgldkvitvqktvttiktivildskvdyrgyqcldtfikrntppgfqassfktv
    evdrkeqvalimnssgstglpkgvqlthenivtrfshardpiygnqvspgtavltvvpfh
    hgfgmfttlgylicgfrvvmltkfdeetflktlqdykctsvilvptlfailnksellnky
    dlsnlveiasggaplskevgeavarrfnlpgvrqgygltettsaiiitpegddkpgasgk
    vvplfkakvidldtkkslgpnrrgevcvkgpmlmkgyvnnpeatkelideegwlhtgdig
    yydeekhffivdrlkslikykgyqvppaelesvllqhpsifdagvagvpdpvagelpgav
    vvlesgknmtekevmdyvasqvsnakrlrggvrfvdevpkgltgkidgraireilkkpv