PDB entry 2d03

View 2d03 on RCSB PDB site
Description: Crystal structure of the G91S mutant of the NNA7 Fab
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2005-07-23, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-glycophorin A type N immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAY86187
    Domains in SCOPe 2.07: d2d03h1
  • Chain 'L':
    Compound: anti-glycophorin A type N immunoglobulin light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2D03 (0-216)
    Domains in SCOPe 2.07: d2d03l1, d2d03l2
  • Heterogens: MES, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2d03H (H:)
    evqlleesgpglvqpsqslsitctvsgfsltsygvhwvrqspgkglewlgviwsggstdy
    naafisrlsiskdnsksqvffkmnslqaddtaiyycarnrgysyamdswgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d03H (H:)
    qlleesgpglvqpsqslsitctvsgfsltsygvhwvrqspgkglewlgviwsggstdyna
    afisrlsiskdnsksqvffkmnslqaddtaiyycarnrgysyamdswgqgtsvtvssakt
    tppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt
    vpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d03L (L:)
    elvmtqsplslpvslgdqasiscrssqslvhssgntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftltisrveaedlgvyycfqsshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn