PDB entry 2cyy

View 2cyy on RCSB PDB site
Description: Crystal structure of PH1519 from Pyrococcus horikosii OT3
Class: DNA binding protein
Keywords: structural genomics, Pyrococcus horikosii OT3, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-07-08, released 2006-09-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative HTH-type transcriptional regulator PH1519
  Species: Pyrococcus horikoshii [TaxId:53953]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O59188 (0-150)
    • modified residue (0)
    • modified residue (66)
    • modified residue (104)
    • modified residue (135)
  Domains in SCOPe 2.04: d2cyya1, d2cyya2
• Heterogens: CA, GLN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cyyA (A:)
  mrvpldeidkkiikilqndgkaplreiskitglaestiherirklresgvikkftaiidp
  ealgysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnf
  ldligsipgvegthtmivlkthkettelpik