PDB entry 2cxe

View 2cxe on RCSB PDB site
Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)
Class: Lyase
Keywords: structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-28, released 2005-12-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.295
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus horikoshii OT3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cxea1, d2cxea2
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus horikoshii OT3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cxeb1, d2cxeb2
  • Chain 'C':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus horikoshii OT3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cxec1, d2cxec2
  • Chain 'D':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus horikoshii OT3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cxed1, d2cxed2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cxeA (A:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lskakvgvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cxeA (A:)
    ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
    makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
    ylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkdd
    enftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqy
    vmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvd
    qihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlv
    iqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglska
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cxeB (B:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lskakvgvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cxeB (B:)
    ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
    makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
    ylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkdd
    enftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqy
    vmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvd
    qihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlv
    iqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglska
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cxeC (C:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lskakvgvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cxeC (C:)
    ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
    makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
    ylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkdd
    enftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqy
    vmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvd
    qihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlv
    iqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglska
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cxeD (D:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lskakvgvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cxeD (D:)
    ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
    makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
    ylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkdd
    enftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqy
    vmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvd
    qihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlv
    iqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglska