PDB entry 2cwx

View 2cwx on RCSB PDB site
Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-1 crystal)
Class: lyase
Keywords: LYASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-27, released 2005-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cwxa1, d2cwxa2
  • Chain 'E':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cwxe1, d2cwxe2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwxA (A:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lskakvgvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwxA (A:)
    vewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtlwklpemakrsma
    kvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppyeyl
    rhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkdden
    ftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqyvm
    idivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvdqi
    htgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlviq
    agggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglska
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2cwxE (E:)
    mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
    lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
    ldfhppyeylrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsg
    gidllkddenftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraem
    vaneggqyvmidivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalak
    aarmigvdqihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpeli
    rlfgkdlviqagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevg
    lskakvgvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwxE (E:)
    wyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrsm
    akvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppyey
    lrhfkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkdde
    nftsfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqyv
    midivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvdq
    ihtgtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlvi
    qagggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslr