PDB entry 2cwv

View 2cwv on RCSB PDB site
Description: Product schiff-base intermediate of copper amine oxidase from arthrobacter globiformis
Class: oxidoreductase
Keywords: COPPER, Amine Oxidase, TOPAQUINONE, TPQ, Catalytic base, Reaction Intermediate, 2-phenethylamine, OXIDOREDUCTASE
Deposited on 2005-06-26, released 2006-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.201
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylethylamine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • engineered (297)
      • modified residue (381)
    Domains in SCOPe 2.06: d2cwva1, d2cwva2, d2cwva3
  • Chain 'B':
    Compound: phenylethylamine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • engineered (297)
      • modified residue (381)
    Domains in SCOPe 2.06: d2cwvb1, d2cwvb2, d2cwvb3
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwvA (A:)
    mtpstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrf
    rvfihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlk
    alaarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvd
    vvskevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiew
    ekwsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfatg
    eylvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlws
    ginytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnis
    qlapglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltre
    seavreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkd
    lwvtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwp
    impvdtvgfklrpegffdrspvldvpanpsqsgshchg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwvA (A:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfatgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cwvB (B:)
    mtpstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrf
    rvfihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlk
    alaarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvd
    vvskevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiew
    ekwsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfatg
    eylvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlws
    ginytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnis
    qlapglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltre
    seavreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkd
    lwvtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwp
    impvdtvgfklrpegffdrspvldvpanpsqsgshchg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwvB (B:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfatgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan