PDB entry 2cwe

View 2cwe on RCSB PDB site
Description: Crystal structure of hypothetical transcriptional regulator protein, PH1932 from Pyrococcus horikoshii OT3
Class: gene regulation
Keywords: Structural Genomics, hypothecital protein, transcription regulator, PSI, Protein Structure Initiative, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, GENE REGULATION
Deposited on 2005-06-20, released 2005-12-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical transcription regulator protein, PH1932
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2cwea1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cweA (A:)
    makkvkvitdpevikvmledtrrkilkllrnkemtisqlseilgktpqtiyhhieklkea
    glvevkrtemkgnlvekyygrtadvfyinlylgdeelryiarsrlktkidifkrlgyqfe
    enellnimdrmsqkefdatvriskyieekedalkdfsnediihaiewlstaelardeeyl
    ellkrlgsilkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cweA (A:)
    akkvkvitdpevikvmledtrrkilkllrnkemtisqlseilgktpqtiyhhieklkeag
    lvevkrtemkgnlvekyygrtadvfyinlylgdeelryiarsrlktkidifkrlgyqfee
    nellnimdrmsqkefdatvriskyieekedalkdfsnediihaiewlstaelardeeyle
    llkrlgsilkr