PDB entry 2cw3

View 2cw3 on RCSB PDB site
Description: X-ray structure of PmSOD2, superoxide dismutase from Perkinsus marinus
Class: oxidoreductase
Keywords: sod, oxidoreductase
Deposited on 2005-06-16, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iron superoxide dismutase
    Species: Perkinsus marinus [TaxId:31276]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cw3a1, d2cw3a2
  • Chain 'B':
    Compound: iron superoxide dismutase
    Species: Perkinsus marinus [TaxId:31276]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cw3b1, d2cw3b2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cw3A (A:)
    mrlsgsdgrrltyrtsprvrasllllgaivllvyfaetlfvvcrgsmdsravrhaipsgk
    glrakpfvpsrsgvapssglrmtlpyglealepvisaatvdfhynkhhqgyiqklldatg
    lpesrinlkslvtlgpdragenvfnaagqiynhnmywlsmvptsgsgrhvpprllklira
    rwgnvdemkenfmrkatalfgsgwiwlvwdtrerrldlvgtkdahsplsedagkiplftc
    dvwehayyldyqhdraayltrwwslinwefadsnlpsdie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cw3A (A:)
    pssglrmtlpyglealepvisaatvdfhynkhhqgyiqklldatglpesrinlkslvtlg
    pdragenvfnaagqiynhnmywlsmvptsgsgrhvpprllklirarwgnvdemkenfmrk
    atalfgsgwiwlvwdtrerrldlvgtkdahsplsedagkiplftcdvwehayyldyqhdr
    aayltrwwslinwefadsnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cw3B (B:)
    mrlsgsdgrrltyrtsprvrasllllgaivllvyfaetlfvvcrgsmdsravrhaipsgk
    glrakpfvpsrsgvapssglrmtlpyglealepvisaatvdfhynkhhqgyiqklldatg
    lpesrinlkslvtlgpdragenvfnaagqiynhnmywlsmvptsgsgrhvpprllklira
    rwgnvdemkenfmrkatalfgsgwiwlvwdtrerrldlvgtkdahsplsedagkiplftc
    dvwehayyldyqhdraayltrwwslinwefadsnlpsdie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cw3B (B:)
    lrmtlpyglealepvisaatvdfhynkhhqgyiqklldatglpesrinlkslvtlgpdra
    genvfnaagqiynhnmywlsmvptsgsgrhvpprllklirarwgnvdemkenfmrkatal
    fgsgwiwlvwdtrerrldlvgtkdahsplsedagkiplftcdvwehayyldyqhdraayl
    trwwslinwefadsnl