PDB entry 2cw2

View 2cw2 on RCSB PDB site
Description: Crystal structure of Superoxide dismutase from P. Marinus
Class: oxidoreductase
Keywords: sod, oxidoreductase
Deposited on 2005-06-16, released 2006-07-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase 1
    Species: Perkinsus marinus [TaxId:31276]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2cw2a1, d2cw2a2
  • Chain 'B':
    Compound: superoxide dismutase 1
    Species: Perkinsus marinus [TaxId:31276]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2cw2b1, d2cw2b2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cw2A (A:)
    mlsvaghrfaslattpvlrmglarcfssvtgpfqcpplpyvknalephmsaetltyhhdk
    hhqtyvdtlnsiaaenstiasktleqiiktetgkpfnqaaqvynhtfffnnlapngggep
    tgkiaelitrdfgsfekfkedfsaaavghfgsgwvwliaddgklkivqghdagnpiresk
    tplmnidvwehayyidyrnaraqyvknywnlvnwdfvndnvakagi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cw2A (A:)
    svtgpfqcpplpyvknalephmsaetltyhhdkhhqtyvdtlnsiaaenstiasktleqi
    iktetgkpfnqaaqvynhtfffnnlapngggeptgkiaelitrdfgsfekfkedfsaaav
    ghfgsgwvwliaddgklkivqghdagnpiresktplmnidvwehayyidyrnaraqyvkn
    ywnlvnwdfvndnvakagi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cw2B (B:)
    mlsvaghrfaslattpvlrmglarcfssvtgpfqcpplpyvknalephmsaetltyhhdk
    hhqtyvdtlnsiaaenstiasktleqiiktetgkpfnqaaqvynhtfffnnlapngggep
    tgkiaelitrdfgsfekfkedfsaaavghfgsgwvwliaddgklkivqghdagnpiresk
    tplmnidvwehayyidyrnaraqyvknywnlvnwdfvndnvakagi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cw2B (B:)
    gpfqcpplpyvknalephmsaetltyhhdkhhqtyvdtlnsiaaenstiasktleqiikt
    etgkpfnqaaqvynhtfffnnlapngggeptgkiaelitrdfgsfekfkedfsaaavghf
    gsgwvwliaddgklkivqghdagnpiresktplmnidvwehayyidyrnaraqyvknywn
    lvnwdfvndnvakagi