PDB entry 2cut

View 2cut on RCSB PDB site
Description: cutinase, a lipolytic enzyme with a preformed oxyanion hole
Deposited on 1994-06-03, released 1994-08-31
The last revision prior to the SCOP 1.67 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d2cut__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cut_ (-)
    lgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvg
    gayratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedld
    sairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpd
    argpapefliekvravrg