PDB entry 2cum

View 2cum on RCSB PDB site
Description: The solution structure of the 33rd fibronectin type III domain of human Tenascin-X
Class: cell adhesion
Keywords: Hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-26, released 2005-11-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-26, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tenascin-X
  Species: HOMO SAPIENS
  Gene: TNXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22105 (7-98)
    • cloning artifact (0-6)
    • cloning artifact (99-104)
  Domains in SCOP 1.73: d2cuma1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cumA (A:)
  gssgssgleaprdleakevtprtalltwteppvrpagyllsfhtpggqtqeillpggits
  hqllglfpstsynarlqamwgqsllppvstsfttgglrisgpssg