PDB entry 2cuh

View 2cuh on RCSB PDB site
Description: Solution structure of the 31st fibronectin type III domain of the human tenascin X
Class: cell adhesion
Keywords: fibronectin type III domain, tenascin X precursor, extracellular matrix, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2005-05-26, released 2005-11-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tenascin-X
  Species: Homo sapiens [TaxId:9606]
  Gene: TNXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22105 (7-108)
    • cloning artifact (0-6)
    • see remark 999 (39)
    • cloning artifact (109-114)
  Domains in SCOPe 2.04: d2cuha1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cuhA (A:)
  gssgssgpdgptqlralnltegfavlhwkppqnpvdtydiqvtapgapplqaetpgsavd
  yplhdlvlhtnytatvrglrgpnltspasitfttgleaprdleakevtpsgpssg