PDB entry 2cub

View 2cub on RCSB PDB site
Description: Solution structure of the SH3 domain of the human cytoplasmic protein Nck1
Class: signaling protein
Keywords: SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-26, released 2005-11-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16333 (7-81)
      • cloning artifact (0-6)
      • cloning artifact (82-87)
    Domains in SCOPe 2.05: d2cuba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cubA (A:)
gssgssgdpgerlydlnmpayvkfnymaeredelslikgtkvivmekcsdgwwrgsyngq
vgwfpsnyvteegdsplgdhvgsgpssg