PDB entry 2cua

View 2cua on RCSB PDB site
Description: the cua domain of cytochrome ba3 from thermus thermophilus
Class: electron transport
Keywords: cua center
Deposited on 1999-02-18, released 1999-05-28
The last revision prior to the SCOP 1.75 freeze date was dated 1999-05-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.226
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cua)
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2cuaa_
  • Chain 'B':
    Compound: protein (cua)
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2cuab_
  • Heterogens: ZN, CUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cuaA (A:)
    aytlathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpn
    pievpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqyc
    glghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cuaA (A:)
    agklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfk
    itspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivv
    ke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cuaB (B:)
    aytlathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpn
    pievpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqyc
    glghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cuaB (B:)
    aytlathtagagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
    vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
    hqnmfgtivvke