PDB entry 2cu1

View 2cu1 on RCSB PDB site
Description: Solution structure of the PB1 domain of human protein kinase MEKK2b
Class: Transferase
Keywords: PB1 domain, Mitogen-activated protein kinase kinase kinase 2, MAPK/ERK kinase kinase 2, MEK kinase 2, MEKK 2, SIGNALING PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase
Deposited on 2005-05-24, released 2005-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase kinase kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K2, MAPKKK2, MEKK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2U5 (7-96)
      • cloning artifact (0-6)
      • engineered (67)
      • cloning artifact (97-102)
    Domains in SCOPe 2.06: d2cu1a1, d2cu1a2, d2cu1a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cu1A (A:)
    gssgssgdvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelvipltt
    qddldkavelldrsihmkslkillvingstqatnlepsgpssg