PDB entry 2cu1

View 2cu1 on RCSB PDB site
Description: Solution structure of the PB1 domain of human protein kinase MEKK2b
Class: Transferase
Keywords: PB1 domain, Mitogen-activated protein kinase kinase kinase 2, MAPK/ERK kinase kinase 2, MEK kinase 2, MEKK 2, SIGNALING PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-24, released 2005-11-24
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mitogen-activated protein kinase kinase kinase 2
  Species: HOMO SAPIENS
  Gene: MAP3K2, MAPKKK2, MEKK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y2U5 (7-96)
    • cloning artifact (0-6)
    • engineered (67)
    • cloning artifact (97-102)
  Domains in SCOP 1.73: d2cu1a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cu1A (A:)
  gssgssgdvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelvipltt
  qddldkavelldrsihmkslkillvingstqatnlepsgpssg