PDB entry 2ct9

View 2ct9 on RCSB PDB site
Description: The crystal structure of calcineurin B homologous proein 1 (CHP1)
Class: metal binding protein
Keywords: EF-hand, calcium binding protein, METAL BINDING PROTEIN
Deposited on 2005-05-23, released 2005-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-binding protein p22
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61023 (Start-194)
      • expression tag (195-202)
    Domains in SCOPe 2.06: d2ct9a1, d2ct9a2
  • Chain 'B':
    Compound: Calcium-binding protein p22
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61023 (Start-194)
      • expression tag (195-202)
    Domains in SCOPe 2.06: d2ct9b1, d2ct9b2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ct9A (A:)
    mgsrastllrdeeleeikketgfshsqitrlysrftsldkgengtlsredfqripelain
    plgdriinaffsegedqvnfrgfmrtlahfrpiednekskdvngpeplnsrsnklhfafr
    lydldkddkisrdellqvlrmmvgvnisdeqlgsiadrtiqeadqdgdsaisftefvkvl
    ekvdveqkmsirflhklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ct9A (A:)
    llrdeeleeikketgfshsqitrlysrftsldkgengtlsredfqripelainplgdrii
    naffsegedqvnfrgfmrtlahfrpieeplnsrsnklhfafrlydldkddkisrdellqv
    lrmmvgvnisdeqlgsiadrtiqeadqdgdsaisftefvkvlekvdveqkmsirflhkla
    aaleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ct9B (B:)
    mgsrastllrdeeleeikketgfshsqitrlysrftsldkgengtlsredfqripelain
    plgdriinaffsegedqvnfrgfmrtlahfrpiednekskdvngpeplnsrsnklhfafr
    lydldkddkisrdellqvlrmmvgvnisdeqlgsiadrtiqeadqdgdsaisftefvkvl
    ekvdveqkmsirflhklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ct9B (B:)
    srastllrdeeleeikketgfshsqitrlysrftsldkgengtlsredfqripelainpl
    gdriinaffsegedqvnfrgfmrtlahfrpiednedvngpeplnsrsnklhfafrlydld
    kddkisrdellqvlrmmvgvnisdeqlgsiadrtiqeadqdgdsaisftefvkvlekvdv
    eqkmsirflhklaaaleh