PDB entry 2csu

View 2csu on RCSB PDB site
Description: Crystal structure of PH0766 from Pyrococcus horikoshii OT3
Class: structural genomics, unknown function
Keywords: Pyrococcus horikoshii, Structural Genomics, PH0766, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, UNKNOWN FUNCTION
Deposited on 2005-05-23, released 2006-08-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.246
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 457aa long hypothetical protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58493 (0-End)
      • modified residue (0)
      • modified residue (121)
      • modified residue (132)
      • modified residue (184)
      • modified residue (193)
      • modified residue (219)
      • modified residue (278)
      • modified residue (281)
      • modified residue (298)
      • modified residue (337)
      • modified residue (346)
      • modified residue (370)
      • modified residue (383)
      • modified residue (408)
      • modified residue (410)
    Domains in SCOPe 2.01: d2csua1, d2csua2, d2csua3
  • Chain 'B':
    Compound: 457aa long hypothetical protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58493 (0-End)
      • modified residue (0)
      • modified residue (121)
      • modified residue (132)
      • modified residue (184)
      • modified residue (193)
      • modified residue (219)
      • modified residue (278)
      • modified residue (281)
      • modified residue (298)
      • modified residue (337)
      • modified residue (346)
      • modified residue (370)
      • modified residue (383)
      • modified residue (408)
      • modified residue (410)
    Domains in SCOPe 2.01: d2csub1, d2csub2, d2csub3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2csuA (A:)
    mldyffnpkgiavigasndpkklgyevfknlkeykkgkvypvnikeeevqgvkayksvkd
    ipdeidlaiivvpkrfvkdtliqcgekgvkgvviitagfgetgeegkreekelveiahky
    gmriigpncvgimnthvdlnatfitvakkgnvafisqsgalgagivyktikedigfskfi
    svgnmadvdfaelmeyladteedkaialyiegvrngkkfmevakrvtkkkpiialkagks
    esgaraasshtgslagswkiyeaafkqsgvlvantidemlsmarafsqplprgnkvaimt
    naggpgvltadeldkrglklatleektieelrsflppmaavknpvdmiasargedyyrta
    klllqdpnvdmliaicvvptfagmtltehaegiiravkevnnekpvlamfmagyvsekak
    ellekngiptyerpedvasaayalveqaknvgileve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2csuA (A:)
    mldyffnpkgiavigasndpkklgyevfknlkeykkgkvypvnikeeevqgvkayksvkd
    ipdeidlaiivvpkrfvkdtliqcgekgvkgvviitagfgetgeegkreekelveiahky
    gmriigpncvgimnthvdlnatfitvakkgnvafisqsgalgagivyktikedigfskfi
    svgnmadvdfaelmeyladteedkaialyiegvrngkkfmevakrvtkkkpiialkagsw
    kiyeaafkqsgvlvantidemlsmarafsqplprgnkvaimtnaggpgvltadeldkrgl
    klatleektieelrsflppmaavknpvdmiasargedyyrtaklllqdpnvdmliaicvv
    ptfagmtltehaegiiravkevnnekpvlamfmagyvsekakellekngiptyerpedva
    saayalveqaknvgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2csuB (B:)
    mldyffnpkgiavigasndpkklgyevfknlkeykkgkvypvnikeeevqgvkayksvkd
    ipdeidlaiivvpkrfvkdtliqcgekgvkgvviitagfgetgeegkreekelveiahky
    gmriigpncvgimnthvdlnatfitvakkgnvafisqsgalgagivyktikedigfskfi
    svgnmadvdfaelmeyladteedkaialyiegvrngkkfmevakrvtkkkpiialkagks
    esgaraasshtgslagswkiyeaafkqsgvlvantidemlsmarafsqplprgnkvaimt
    naggpgvltadeldkrglklatleektieelrsflppmaavknpvdmiasargedyyrta
    klllqdpnvdmliaicvvptfagmtltehaegiiravkevnnekpvlamfmagyvsekak
    ellekngiptyerpedvasaayalveqaknvgileve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2csuB (B:)
    mldyffnpkgiavigasndpkklgyevfknlkeykkgkvypvnikeeevqgvkayksvkd
    ipdeidlaiivvpkrfvkdtliqcgekgvkgvviitagfgetgeegkreekelveiahky
    gmriigpncvgimnthvdlnatfitvakkgnvafisqsgalgagivyktikedigfskfi
    svgnmadvdfaelmeyladteedkaialyiegvrngkkfmevakrvtkkkpiialkagkk
    iyeaafkqsgvlvantidemlsmarafsqplprgnkvaimtnaggpgvltadeldkrglk
    latleektieelrsflppmaavknpvdmiasargedyyrtaklllqdpnvdmliaicvvp
    tfagmtltehaegiiravkevnnekpvlamfmagyvsekakellekngiptyerpedvas
    aayalveqaknvgi