PDB entry 2crv

View 2crv on RCSB PDB site
Description: Solution structure of C-terminal domain of mitochondrial translational initiationfactor 2
Class: translation
Keywords: ribosome, translation, beta barrel, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Translation initiation factor IF-2
  Species: Mus musculus [TaxId:10090]
  Gene: Mtif2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q91YJ5 (7-113)
    • cloning artifact (0-6)
    • cloning artifact (114-119)
  Domains in SCOPe 2.08: d2crva1, d2crva2, d2crva3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2crvA (A:)
  gssgssgypigeasilatftvtegkkkipvadcrvqkgqlerhkkfklirngqviwkgsl
  tslkhhkddisviktgmdcglsldeekvefkpgdqvicyeenkvptktswdpgfsgpssg