PDB entry 2cru

View 2cru on RCSB PDB site
Description: Solution structure of programmed cell death 5
Class: apoptosis
Keywords: three helix bundle, apoptosis, DNA binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD5, TFAR19
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14737 (7-111)
      • cloning artifact (0-6)
      • cloning artifact (112-117)
    Domains in SCOPe 2.06: d2crua1, d2crua2, d2crua3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cruA (A:)
gssgssglrrqrlaelqakhgdpgdaaqqeakhreaemrnsilaqvldqsararlsnlal
vkpektkavenyliqmarygqlsekvseqglieilkkvsqqtektttvkfnrsgpssg