PDB entry 2crk

View 2crk on RCSB PDB site
Description: muscle creatine kinase
Class: transferase
Keywords: creatine kinase, transferase
Deposited on 1998-09-28, released 1999-01-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (creatine kinase)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2crka1, d2crka2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2crkA (A:)
    mpfgnthnkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtg
    vdnpghpfimtvgcvagdeesytvfkdlfdpiiqdrhggfkptdkhktdlnhenlkggdd
    ldphyvlssrvrtgrsikgytlpphcsrgerraveklsvealnsltgefkgkyyplksmt
    eqeqqqliddhflfdkpvsplllasgmardwpdargiwhndnksflvwvneedhlrvism
    ekggnmkevfrrfcvglqkieeifkkaghpfmwnehlgyvltcpsnlgtglrggvhvkla
    hlskhpkfeeiltrlrlqkrgtsvfdtaavgsvfdisnadrlgsseveqvqlvvdgvklm
    vemekklekgqsiddmipaqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2crkA (A:)
    nkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtgvdnpghp
    fimtvgcvagdeesytvfkdlfdpiiqdrhggfkptdkhktdlnhenlkggddldphyvl
    ssrvrtgrsikgytlpphcsrgerraveklsvealnsltgefkgkyyplksmteqeqqql
    iddhflfdkpvsplllasgmardwpdargiwhndnksflvwvneedhlrvismekggnmk
    evfrrfcvglqkieeifkkaghpfmwnehlgyvltcpsnlgtglrggvhvklahlskhpk
    feeiltrlrlqkrgtsvfdisnadrlgsseveqvqlvvdgvklmvemekklekgqsiddm
    ipaqk