PDB entry 2crf

View 2crf on RCSB PDB site
Description: Solution structure of the Ran_BP1 domain of RAN-binding protein-3
Class: transport protein
Keywords: Ran_BP1 domain, Ran-binding protein 3, RanBP3, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAN binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RANBP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6Z4 (7-143)
      • cloning artifact (0-6)
      • cloning artifact (144-149)
    Domains in SCOPe 2.05: d2crfa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2crfA (A:)
    gssgssgtarkcllekvevitgeeaesnvlqmqcklfvfdktsqswvergrgllrlndma
    stddgtlqsrlvmrtqgslrlilntklwaqmqidkaseksihitamdtedqgvkvflisa
    sskdtgqlyaalhhrilalrsrvesgpssg