PDB entry 2cr5

View 2cr5 on RCSB PDB site
Description: Solution structure of the UBX domain of D0H8S2298E protein
Class: structural genomics, unknown function
Keywords: UBX domain, Reproduction 8, D0H8S2298E protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reproduction 8
    Species: Mus musculus [TaxId:10090]
    Gene: D0H8S2298E, Rep-8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZ49 (7-102)
      • expression tag (0-6)
      • expression tag (103-108)
    Domains in SCOPe 2.01: d2cr5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cr5A (A:)
    gssgssgevpdlpeepsetaeevvtvalrcpngrvlrrrffkswnsqvlldwmmkvgyhk
    slyrlstsfprraleveggssledigitvdtvlnveekeqssqsgpssg