PDB entry 2cr5

View 2cr5 on RCSB PDB site
Description: The deposition and citation title is: Solution structure of the UBX domain of D0H8S2298E protein
Class: structural genomics, unknown function
Keywords: UBX domain, Reproduction 8, D0H8S2298E protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Reproduction 8
  Species: MUS MUSCULUS
  Gene: D0H8S2298E, Rep-8
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QZ49 (7-102)
    • cloning artifact (0-6)
    • cloning artifact (103-108)
  Domains in SCOP 1.73: d2cr5a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cr5A (A:)
  gssgssgevpdlpeepsetaeevvtvalrcpngrvlrrrffkswnsqvlldwmmkvgyhk
  slyrlstsfprraleveggssledigitvdtvlnveekeqssqsgpssg