PDB entry 2cqm

View 2cqm on RCSB PDB site
Description: Solution structure of the mitochondrial ribosomal protein L17 isolog
Class: Translation
Keywords: alpha and beta (a+b), Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribosomal protein L17 isolog
  Species: HOMO SAPIENS
  Gene: MRPL17
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NRX2 (7-115)
    • cloning artifact (0-6)
    • cloning artifact (116-121)
  Domains in SCOP 1.75: d2cqma1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cqmA (A:)
  gssgssgllrnlltglvrherieapwarvdemrgyaeklidygklgdtneramrmadfwl
  tekdlipklfqvlaprykdqtggytrmlqipnrsldrakmavieykgnclpplplpsgps
  sg