PDB entry 2cql

View 2cql on RCSB PDB site
Description: Solution structure of the N-terminal domain of human ribosomal protein L9
Class: translation
Keywords: N-terminal domain, alpha and beta (a+b), Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSLATION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60S ribosomal protein L9
    Species: Homo sapiens [TaxId:9606]
    Gene: RPL9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32969 (7-93)
      • cloning artifact (0-6)
      • cloning artifact (94-99)
    Domains in SCOPe 2.08: d2cqla1, d2cqla2, d2cqla3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cqlA (A:)
    gssgssgmktilsnqtvdipenvditlkgrtvivkgprgtlrrdfnhinvelsllgkkkk
    rlrvdkwwgnrkelatvrticshvqnmikgvtlgsgpssg